PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN22167.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YB
Protein Properties Length: 108aa    MW: 12037.8 Da    PI: 5.9122
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN22167.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1481.9e-4623108287
       NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 
                 re drflPianvsrimkk+l anaki k aketvqecvsefisf+ +easdkcqrekrk ingddllwa++tlGfedyveplk yl
  KHN22167.1  23 RELDRFLPIANVSRIMKKALLANAKILKYAKETVQECVSEFISFIIDEASDKCQREKRKVINGDDLLWAMTTLGFEDYVEPLKGYL 108
                 789********************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.7E-4221108IPR009072Histone-fold
SuperFamilySSF471137.3E-3126108IPR009072Histone-fold
PfamPF008087.4E-232892IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006158.0E-175674No hitNo description
PRINTSPR006158.0E-177593No hitNo description
PRINTSPR006158.0E-1794108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 108 aa     Download sequence    Send to blast
MADSDNDSGG AHNSGKGGKV LPRELDRFLP IANVSRIMKK ALLANAKILK YAKETVQECV  60
SEFISFIIDE ASDKCQREKR KVINGDDLLW AMTTLGFEDY VEPLKGYL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B6e-3923108287Transcription factor HapC (Eurofung)
4g92_B6e-3923108287Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0178303e-74BT017830.1 Zea mays clone EL01N0508H10.c mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006602134.11e-65PREDICTED: nuclear transcription factor Y subunit B-3
SwissprotO233101e-58NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A0B2QR591e-75A0A0B2QR59_GLYSO; Nuclear transcription factor Y subunit B-3
TrEMBLK7KDZ51e-75K7KDZ5_SOYBN; Uncharacterized protein
STRINGGLYMA03G22721.13e-75(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.13e-50nuclear factor Y, subunit B3
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]